E2F4 antibody (AA 106-144)
-
- Target See all E2F4 Antibodies
- E2F4 (E2F Transcription Factor 4, P107/p130-Binding (E2F4))
-
Binding Specificity
- AA 106-144
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This E2F4 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids 106-144 (ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) from the human protein were used as the immunogen for the E2F4 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product E2F4 Primary Antibody
-
-
- Application Notes
- Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the E2F4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- E2F4 (E2F Transcription Factor 4, P107/p130-Binding (E2F4))
- Alternative Name
- E2F4 (E2F4 Products)
- Background
- E2F4 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two.
- UniProt
- Q16254
- Pathways
- Cell Division Cycle, Mitotic G1-G1/S Phases, Regulation of Cell Size
-