BAX antibody (AA 17-48)

Catalog No. ABIN5647494

Product Details anti-BAX Antibody

Target: BAX (BCL2-Associated X Protein (BAX))

Binding Specificity: AA 17-48

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BAX antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Bax antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-2 μg/10^6 cells

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Bax antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for BAX

Target: BAX (BCL2-Associated X Protein (BAX))

Alternative Name: Bax (BAX Products)

Synonyms: BAX-ALPHA antibody, bax-A antibody, xBax antibody, xlbax antibody, BAX antibody, bax antibody, fj16e01 antibody, wu:fc50b10 antibody, wu:fj16e01 antibody, BCL2L4 antibody, zgc:112983 antibody, BCL2 associated X, apoptosis regulator antibody, BCL2-associated X protein L homeolog antibody, BCL2-associated X protein antibody, bcl2-associated X protein, a antibody, bcl2-associated X protein, b antibody, BAX antibody, bax.L antibody, bax antibody, baxa antibody, Bax antibody, baxb antibody

Background: Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

UniProt: Q07812

Pathways: p53 Signaling, PI3K-Akt Signaling, Apoptosis, Caspase Cascade in Apoptosis, Positive Regulation of Endopeptidase Activity, Unfolded Protein Response