HTRA3 antibody (AA 330-362)

Catalog No. ABIN5647345

Product Details anti-HTRA3 Antibody

Target: HTRA3 (HtrA Serine Peptidase 3 (HTRA3))

Binding Specificity: AA 330-362

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HTRA3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 330-362 (FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR) from the human protein were used as the immunogen for the HtrA3 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HtrA3 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HtrA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HTRA3

Target: HTRA3 (HtrA Serine Peptidase 3 (HTRA3))

Alternative Name: HtrA3 (HTRA3 Products)

Synonyms: HTRA3 antibody, Prsp antibody, Tasp antibody, 2210021K23Rik antibody, 9530081K03Rik antibody, RGD1308120 antibody, Trypsin-like serine protease antibody, HtrA serine peptidase 3 antibody, htrA3 antibody, HTRA3 antibody, Htra3 antibody

Background: Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.

UniProt: P83110