PPL antibody (AA 1664-1701)

Catalog No. ABIN5647242

Product Details anti-PPL Antibody

Target: PPL (Periplakin (PPL))

Binding Specificity: AA 1664-1701

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPL antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 1664-1701 (DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK) from the human protein were used as the immunogen for the Periplakin antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Periplakin antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Periplakin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PPL

Target: PPL (Periplakin (PPL))

Alternative Name: Periplakin (PPL Products)

Synonyms: cb180 antibody, sb:cb180 antibody, im:7140067 antibody, im:7149519 antibody, AW553870 antibody, periplakin antibody, periplakin L homeolog antibody, PPL antibody, ppl antibody, ppl.L antibody, Ppl antibody

Background: Periplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.

UniProt: O60437