NFIA antibody (AA 180-224)

Catalog No. ABIN5647218

Product Details anti-NFIA Antibody

Target: NFIA (Nuclear Factor I/A (NFIA))

Binding Specificity: AA 180-224

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NFIA antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Purification: Antigen affinity purified

Immunogen: Amino acids 180-224 (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) from the human protein were used as the immunogen for the NFIA antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the NFIA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for NFIA

Target: NFIA (Nuclear Factor I/A (NFIA))

Alternative Name: NFIA (NFIA Products)

Synonyms: NFIA antibody, CTF antibody, NF-I/A antibody, NF1-A antibody, NFI-A antibody, NFI-L antibody, si:ch211-88d2.2 antibody, wu:fq27e07 antibody, zgc:158351 antibody, CNFI-A antibody, cNFI-A3 antibody, 1110047K16Rik antibody, 9430022M17Rik antibody, NF1A antibody, nuclear factor I A antibody, nuclear factor I/A antibody, NFIA antibody, nfia antibody, Nfia antibody

Background: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

UniProt: Q12857