ACTN3 antibody (AA 574-617)

Catalog No. ABIN5647038

Product Details anti-ACTN3 Antibody

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Binding Specificity: AA 574-617

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTN3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK from the human protein were used as the immunogen for the ACTN3 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ACTN3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ACTN3

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Alternative Name: ACTN3 (ACTN3 Products)

Synonyms: CG8953 antibody, Dmel\\CG8953 antibody, ORF1 antibody, acta-3 antibody, dabp antibody, ACTN2 antibody, actn3 antibody, actnl antibody, zgc:63559 antibody, fb95c03 antibody, wu:fb95c03 antibody, wu:fc11d03 antibody, zgc:77243 antibody, actinin alpha 3 (gene/pseudogene) antibody, actinin alpha 3 antibody, alpha actinin 3 antibody, actinin alpha 3a antibody, actinin alpha 3 (gene/pseudogene) L homeolog antibody, alpha-actinin-3 antibody, actinin alpha 3b antibody, ACTN3 antibody, Actn3 antibody, actn3a antibody, actn3.L antibody, actn3 antibody, LOC100439754 antibody, actn3b antibody

Background: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

UniProt: Q08043

Pathways: Cell-Cell Junction Organization