Annexin VIII antibody (AA 20-61)
-
- Target See all Annexin VIII (ANXA8) Antibodies
- Annexin VIII (ANXA8) (Annexin A8 (ANXA8))
-
Binding Specificity
- AA 20-61
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Annexin VIII antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody.
- Isotype
- IgG
- Top Product
- Discover our top product ANXA8 Primary Antibody
-
-
- Application Notes
- Optimal dilution of the Annexin VIII antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the Annexin VIII antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Annexin VIII (ANXA8) (Annexin A8 (ANXA8))
- Alternative Name
- Annexin VIII (ANXA8 Products)
- Background
- ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
- UniProt
- P13928
-