Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

AGO1 antibody (AA 376-409)

EIF2C1 Reactivity: Human, Mouse, Rat WB, IHC (p), FACS Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5646975
  • Target See all AGO1 (EIF2C1) Antibodies
    AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))
    Binding Specificity
    • 10
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    AA 376-409
    Reactivity
    • 30
    • 16
    • 6
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 33
    • 1
    • 1
    • 1
    Rabbit
    Clonality
    • 32
    • 4
    Polyclonal
    Conjugate
    • 23
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This AGO1 antibody is un-conjugated
    Application
    • 23
    • 12
    • 9
    • 7
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)
    Purification
    Antigen affinity purified
    Immunogen
    Amino acids 376-409 (EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR) from the human protein were used as the immunogen for the AGO1 antibody.
    Isotype
    IgG
  • Application Notes
    Optimal dilution of the AGO1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,IHC (FFPE): 1-2 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the AGO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))
    Alternative Name
    AGO1 / Argonaute 1 (EIF2C1 Products)
    Synonyms
    Ago antibody, Ago-1 antibody, Ago1 antibody, CG6671 antibody, Dm Ago1 antibody, Dmel\\CG6671 antibody, MRE20 antibody, ago1 antibody, ago1-1 antibody, anon-WO0257455.29 antibody, dAGO1 antibody, dAgo1 antibody, l(2)04845 antibody, l(2)4845 antibody, l(2)k00208 antibody, l(2)k08121 antibody, GB12654 antibody, dsim_GLEANR_9718 antibody, DsimGD25729 antibody, GD25729 antibody, EIF2C1 antibody, EIF2C antibody, GERP95 antibody, Q99 antibody, Eif2c1 antibody, ARGONAUTE 1 antibody, T1N15.2 antibody, T1N15_2 antibody, Argonaute-1 antibody, protein argonaute-2 antibody, argonaute 1 antibody, Argonaute 1 antibody, protein argonaute-1 antibody, argonaute 1, RISC catalytic component antibody, argonaute RISC catalytic subunit 1 antibody, Stabilizer of iron transporter SufD / Polynucleotidyl transferase antibody, AGO1 antibody, LOC552062 antibody, ago1 antibody, LOC659936 antibody, Dsim\AGO1 antibody, Ago1 antibody, LOC100386910 antibody, LOC100482671 antibody, LOC475337 antibody
    Background
    This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.
    UniProt
    Q9UL18
    Pathways
    Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization
You are here:
Support