Integrin alpha 3b antibody (Cytoplasmic Domain, N-Term)
Reactivity: Human
IHC, WB, IHC (fro)
Host: Mouse
Monoclonal
54B3
unconjugated
-
- Target See all Integrin alpha 3b products
- Integrin alpha 3b
- Binding Specificity
- Cytoplasmic Domain, N-Term
- Reactivity
- Human
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This Integrin alpha 3b antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Specificity
- Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart
- Cross-Reactivity (Details)
- Human
- Characteristics
- Mouse monoclonal Integrin alpha 3B antibody
- Immunogen
- Integrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin as the immunogen.
- Clone
- 54B3
- Isotype
- IgG1
-
-
- Application Notes
- IHC: 1:25-1:200, WB: 1:100-1:1000
- Restrictions
- For Research Use only
-
- Buffer
- Supplied in PBS containing 0.09 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C
-
- Target
- Integrin alpha 3b
- Abstract
- Integrin alpha 3b Products
-
You are here:
