Integrin alpha 3a antibody (Cytoplasmic Domain, N-Term, Non-phosphorylated)

Catalog No. ABIN5618629

Product Details anti-Integrin alpha 3a Antibody

Target: Integrin alpha 3a

Binding Specificity: Cytoplasmic Domain, N-Term, Non-phosphorylated

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This Integrin alpha 3a antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Specificity: Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A

Cross-Reactivity (Details): Human

Characteristics: Mouse monoclonal Integrin alpha 3A antibody

Immunogen: Integrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin as the immunogen.

Clone: 158A3

Isotype: IgG2a

Application Details

Application Notes: IHC: 1:100-1:200, WB: 1:100-1:1000

Restrictions: For Research Use only

Handling

Buffer: Supplied in PBS containing 0.09 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C

Target Details for Integrin alpha 3a

Target: Integrin alpha 3a

Abstract: Integrin alpha 3a Products