Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RPS6 antibody (N-Term)

RPS6 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5518869
  • Target See all RPS6 Antibodies
    RPS6 (Ribosomal Protein S6 (RPS6))
    Binding Specificity
    • 45
    • 25
    • 22
    • 21
    • 15
    • 15
    • 14
    • 11
    • 9
    • 9
    • 7
    • 5
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 13-52, N-Term
    Reactivity
    • 146
    • 125
    • 112
    • 12
    • 12
    • 10
    • 10
    • 9
    • 8
    • 8
    • 7
    • 7
    • 5
    • 5
    • 5
    • 4
    • 2
    • 2
    • 2
    • 1
    Human, Mouse, Rat
    Host
    • 163
    • 10
    • 3
    • 2
    Rabbit
    Clonality
    • 165
    • 13
    Polyclonal
    Conjugate
    • 89
    • 11
    • 9
    • 7
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    This RPS6 antibody is un-conjugated
    Application
    • 144
    • 67
    • 45
    • 40
    • 40
    • 35
    • 28
    • 18
    • 10
    • 10
    • 9
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    QKLIEVDDER KLRTFYEKRM ATEVAADALG EEWKGYVVRI
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: ribosomal protein S6
    Protein Name: 40S ribosomal protein S6
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product RPS6 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Target
    RPS6 (Ribosomal Protein S6 (RPS6))
    Alternative Name
    RPS6 (RPS6 Products)
    Synonyms
    S6 antibody, rps6 antibody, rps6a antibody, S6R antibody, (Rp)S6 antibody, CG10944 antibody, DS6 antibody, Dmel\\CG10944 antibody, M(1)7BC antibody, M(1)7C antibody, RPS6 antibody, Rp S6 antibody, Rps6 antibody, air8 antibody, air[8] antibody, anon-WO02059370.61 antibody, hen antibody, l(1)air8 antibody, l(1)air[8] antibody, l(1)hen antibody, pp30 antibody, rpS6 antibody, wu:fa92e06 antibody, wu:fb64g06 antibody, zgc:92237 antibody, ribosomal protein S6 antibody, ribosomal protein S6 S homeolog antibody, S6 ribosomal protein antibody, Ribosomal protein S6 antibody, 30S ribosomal protein S6 antibody, 40S ribosomal protein S6 antibody, RPS6 antibody, rps6.S antibody, LOC100135859 antibody, Rps6 antibody, RpS6 antibody, rps6 antibody, rps-6 antibody, LOC100533219 antibody
    Background
    Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.

    Synonyms: Air8 | NP33 | Phosphoprotein NP33 | Pp30 | RP S6 | RPS6 | RS6 | S6 | P62753
    Gene ID
    6194
    UniProt
    P62753
    Pathways
    Carbohydrate Homeostasis, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
You are here:
Support