RPS6 antibody (N-Term)
-
- Target See all RPS6 Antibodies
- RPS6 (Ribosomal Protein S6 (RPS6))
-
Binding Specificity
- AA 13-52, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPS6 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- QKLIEVDDER KLRTFYEKRM ATEVAADALG EEWKGYVVRI
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ribosomal protein S6
Protein Name: 40S ribosomal protein S6 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product RPS6 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- RPS6 (Ribosomal Protein S6 (RPS6))
- Alternative Name
- RPS6 (RPS6 Products)
- Background
-
Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.
Synonyms: Air8 | NP33 | Phosphoprotein NP33 | Pp30 | RP S6 | RPS6 | RS6 | S6 | P62753 - Gene ID
- 6194
- UniProt
- P62753
- Pathways
- Carbohydrate Homeostasis, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-