MSI1 antibody (N-Term)

Catalog No. ABIN5518855

Product Details anti-MSI1 Antibody

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Binding Specificity: AA 21-54, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSI1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for RNA-binding protein Musashi homolog 1(MSI1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for RNA-binding protein Musashi homolog 1(MSI1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: musashi RNA binding protein 1
Protein Name: RNA-binding protein Musashi homolog 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for MSI1

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Alternative Name: MSI1 (MSI1 Products)

Synonyms: CG5099 antibody, DMSIDNA antibody, Dmel\\CG5099 antibody, Msi antibody, SIDNA antibody, anon-EST:Liang-2.35 antibody, clone 2.35 antibody, Msi1h antibody, Musashi antibody, Musashi-1 antibody, Musashi1 antibody, XNrp-1 antibody, nrp-1B antibody, Dsim\\GD21224 antibody, GD21224 antibody, dsim_GLEANR_4982 antibody, msi antibody, musashi antibody, Musahi1 antibody, m-Msi-1 antibody, msi1h antibody, musashi antibody, musashi RNA binding protein 1 antibody, GD21224 gene product from transcript GD21224-RD antibody, musashi RNA-binding protein 1 antibody, musashi RNA binding protein 1 S homeolog antibody, msi antibody, msi1 antibody, Dsim\msi antibody, MSI1 antibody, Msi1 antibody, msi1.S antibody

Background: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

Synonyms: Msi 1 | Msi1 | Musashi-1 | Musashi1 | O43347

Gene ID: 4440

UniProt: O43347

Pathways: Stem Cell Maintenance