HTRA3 antibody (C-Term)

Catalog No. ABIN5518848

Product Details anti-HTRA3 Antibody

Target: HTRA3 (HtrA Serine Peptidase 3 (HTRA3))

Binding Specificity: AA 330-362, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HTRA3 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Serine protease HTRA3(HTRA3) detection. Tested with WB in Human.

Sequence: FAIPSDRITR FLTEFQDKQI KDWKKRFIGI RMR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Serine protease HTRA3(HTRA3) detection. Tested with WB in Human.
Gene Name: HtrA serine peptidase 3
Protein Name: Serine protease HTRA3

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3 (330-362aa FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HTRA3

Target: HTRA3 (HtrA Serine Peptidase 3 (HTRA3))

Alternative Name: HTRA3 (HTRA3 Products)

Synonyms: HTRA3 antibody, Prsp antibody, Tasp antibody, 2210021K23Rik antibody, 9530081K03Rik antibody, RGD1308120 antibody, Trypsin-like serine protease antibody, HtrA serine peptidase 3 antibody, htrA3 antibody, HTRA3 antibody, Htra3 antibody

Background: Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.

Synonyms: HTRA3 | PRSP | Tasp | P83110

Gene ID: 94031

UniProt: P83110