TUB antibody (C-Term)

Catalog No. ABIN5518797

Product Details anti-TUB Antibody

Target: TUB (Tubby Homolog (TUB))

Binding Specificity: AA 395-429, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUB antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Tubby protein homolog(TUB) detection. Tested with WB in Human.

Sequence: VHERVSIRPR NEHETLLARW QNKNTESIIE LQNKT

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Tubby protein homolog(TUB) detection. Tested with WB in Human.
Gene Name: tubby bipartite transcription factor
Protein Name: Tubby protein homolog

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TUB 1 (395-429aa VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for TUB

Target: TUB (Tubby Homolog (TUB))

Alternative Name: TUB (TUB Products)

Synonyms: rd5 antibody, tubby antibody, MGC79522 antibody, TUB antibody, MGC80126 antibody, MGC84061 antibody, tub antibody, tubby bipartite transcription factor antibody, tubby bipartite transcription factor S homeolog antibody, tub antibody, TUB antibody, tub.S antibody, Tub antibody

Background: Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.

Synonyms: rd5 | TUB 1 | TUB | P50607

Gene ID: 7275

UniProt: P50607

Pathways: RTK Signaling, Sensory Perception of Sound