TECTA antibody (N-Term)
-
- Target See all TECTA Antibodies
- TECTA (Tectorin alpha (TECTA))
-
Binding Specificity
- AA 93-134, N-Term
- Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TECTA antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- RAFVAPFWAD VHNGIRGEIY YRETMEPAIL KRATKDIRKY FK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: tectorin alpha
Protein Name: Alpha-tectorin - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK), different from the related mouse sequence by three amino acids.
- Isotype
- IgG
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TECTA (Tectorin alpha (TECTA))
- Alternative Name
- TECTA (TECTA Products)
- Background
-
Alpha-tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.
Synonyms: Alpha-tectorin | DFNA12 | DFNA8 | DFNB21 | TECTA | O75443 - Gene ID
- 7007
- UniProt
- O75443
- Pathways
- Sensory Perception of Sound
-