PDE5A antibody (N-Term)

Catalog No. ABIN5518785

Product Details anti-PDE5A Antibody

Target: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Binding Specificity: AA 20-63, N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDE5A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for cGMP-specific 3',5'-cyclic phosphodiesterase(PDE5A) detection. Tested with WB, IHC-P in Human,Rat.

Sequence: QKQQQRDQDS VEAWLDDHWD FTFSYFVRKA TREMVNAWFA ERVH

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for cGMP-specific 3',5'-cyclic phosphodiesterase(PDE5A) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: phosphodiesterase 5A
Protein Name: cGMP-specific 3',5'-cyclic phosphodiesterase

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A (20-63aa QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH), different from the related mouse sequence by eight amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PDE5A

Target: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Alternative Name: PDE5A (PDE5A Products)

Synonyms: CGB-PDE antibody, CN5A antibody, PDE5 antibody, PDE5A2 antibody, Cgbpde antibody, Cn5n antibody, Pde5 antibody, Pde5a1 antibody, PDE5A antibody, pde5a antibody, cgb-pde antibody, cn5a antibody, pde5 antibody, pde5a1 antibody, phosphodiesterase 5A antibody, phosphodiesterase 5A, cGMP-specific antibody, phosphodiesterase 5A S homeolog antibody, phosphodiesterase 5A, cGMP-specific, b antibody, PDE5A antibody, Pde5a antibody, pde5a.S antibody, pde5ab antibody, pde5a antibody

Background: CGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.

Synonyms: CGB PDE | CGB-PDE | CGBPDE | CN5A | CN5N | PDE 5 | PDE 5A | PDE5 | Pde5a | PDE5A1 | O76074

Gene ID: 8654

UniProt: O76074

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling