NAA15 antibody (N-Term)

Catalog No. ABIN5518778

Product Details anti-NAA15 Antibody

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Binding Specificity: AA 244-287, N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAA15 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for N-alpha-acetyltransferase 15, NatA auxiliary subunit(NAA15) detection. Tested with WB, IHC-P in Human,Mouse.

Sequence: ADVYRGLQER NPENWAYYKG LEKALKPANM LERLKIYEEA WTKY

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for N-alpha-acetyltransferase 15, NatA auxiliary subunit(NAA15) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: N(alpha)-acetyltransferase 15, NatA auxiliary subunit
Protein Name: N-alpha-acetyltransferase 15, NatA auxiliary subunit

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NARG1 (244-287aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY), different from the related mouse sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for NAA15

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Alternative Name: NAA15 (NAA15 Products)

Synonyms: Ga19 antibody, NARG1 antibody, NATH antibody, TBDN100 antibody, 5730450D16Rik antibody, 6330400I15 antibody, ASTBDN antibody, Narg1 antibody, Tbdn-1 antibody, mNAT1 antibody, narg1l antibody, N(alpha)-acetyltransferase 15, NatA auxiliary subunit antibody, N(alpha)-acetyltransferase 15, NatA auxiliary subunit S homeolog antibody, NAA15 antibody, Naa15 antibody, naa15.S antibody

Background: NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (Nα-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE.

Synonyms: ASTBDN | GA19 | mNAT1 | Naa15 | NATH | Tbdn 1 | Tbdn100 | tubedown-1 | Q9BXJ9

Gene ID: 80155