JAK1 antibody (N-Term)
-
- Target See all JAK1 Antibodies
- JAK1 (Janus Kinase 1 (JAK1))
-
Binding Specificity
- AA 78-115, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This JAK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Tyrosine-protein kinase JAK1(JAK1) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- FALYDENTKL WYAPNRTITV DDKMSLRLHY RMRFYFTN
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Tyrosine-protein kinase JAK1(JAK1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Janus kinase 1
Protein Name: Tyrosine-protein kinase JAK1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78-115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN), different from the related mouse sequence by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product JAK1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).
: "
-
Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).
-
- Target
- JAK1 (Janus Kinase 1 (JAK1))
- Alternative Name
- JAK1 (JAK1 Products)
- Synonyms
- JAK1A antibody, JAK1B antibody, JTK3 antibody, AA960307 antibody, C130039L05Rik antibody, wu:fb93e10 antibody, jak1 antibody, Janus kinase 1 antibody, tyrosine-protein kinase JAK1 antibody, JAK1 antibody, Jak1 antibody, jak1 antibody, LOC100286690 antibody
- Background
-
JAK1 (JANUS KINASE 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-α/β) and type II (IFN-γ) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.
Synonyms: JAK 1A | JAK-1 | JAK1A | JAK1B | Tyrosineprotein kinase JAK1 | Tyrosine-protein kinase JAK1 | P23458 - Gene ID
- 3716
- UniProt
- P23458
- Pathways
- JAK-STAT Signaling, RTK Signaling, Interferon-gamma Pathway, Hepatitis C, Toll-Like Receptors Cascades, Unfolded Protein Response
-