Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

HMGB1 antibody (C-Term)

HMGB1 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5518759
  • Target See all HMGB1 Antibodies
    HMGB1 (High Mobility Group Box 1 (HMGB1))
    Binding Specificity
    • 22
    • 16
    • 16
    • 11
    • 8
    • 6
    • 6
    • 5
    • 5
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 124-154, C-Term
    Reactivity
    • 155
    • 93
    • 92
    • 13
    • 11
    • 11
    • 10
    • 8
    • 7
    • 6
    • 6
    • 6
    • 5
    • 2
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 134
    • 30
    • 2
    • 2
    • 2
    • 1
    Rabbit
    Clonality
    • 125
    • 46
    Polyclonal
    Conjugate
    • 87
    • 17
    • 16
    • 6
    • 5
    • 5
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    This HMGB1 antibody is un-conjugated
    Application
    • 138
    • 60
    • 47
    • 45
    • 31
    • 29
    • 27
    • 26
    • 21
    • 10
    • 9
    • 5
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    DVAKKLGEMW NNTAADDKQP YEKKAAKLKE K
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: high mobility group box 1
    Protein Name: High mobility group protein B1
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product HMGB1 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Jia, Sun, Hu, Li, Ruan: "Propofol inhibits the release of interleukin-6, 8 and tumor necrosis factor-α correlating with high-mobility group box 1 expression in lipopolysaccharides-stimulated RAW 264.7 cells." in: BMC anesthesiology, Vol. 17, Issue 1, pp. 148, (2018) (PubMed).

    Ruisong, Xiaorong, Gangying, Chunfeng, Changjiang, Xuefei, Yuanhong, Hong: "The Protective Role of Interleukin-33 in Myocardial Ischemia and Reperfusion Is Associated with Decreased HMGB1 Expression and Up-Regulation of the P38 MAPK Signaling Pathway." in: PLoS ONE, Vol. 10, Issue 11, pp. e0143064, (2016) (PubMed).

    Li, Zhou, Zhou, Zou: "Galantamine protects against lipopolysaccharide-induced acute lung injury in rats." in: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 49, Issue 2, pp. e5008, (2016) (PubMed).

    Bi, Zhu, Yan, Chen, Wang, Ma, Yang: "Association of Upregulated HMGB1 and c-IAP2 Proteins With Hepatocellular Carcinoma Development and Progression." in: Hepatitis monthly, Vol. 14, Issue 12, pp. e23552, (2015) (PubMed).

  • Target
    HMGB1 (High Mobility Group Box 1 (HMGB1))
    Alternative Name
    HMGB1 (HMGB1 Products)
    Background
    High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

    Synonyms: Amphoterin | HMG-1 | HMG1 | HMG3 | HMGB 1 | HMGB1 | SBP 1 | P09429
    Gene ID
    3146
    UniProt
    P09429
    Pathways
    p53 Signaling, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, Inflammasome
You are here:
Support