alpha Defensin 1 antibody (C-Term)

Catalog No. ABIN5518754

Product Details anti-alpha Defensin 1 Antibody

Target: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Binding Specificity: AA 65-94, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This alpha Defensin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection. Tested with WB in Human,Rat.

Sequence: ACYCRIPACI AGERRYGTCI YQGRLWAFCC

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection. Tested with WB in Human,Rat.
Gene Name: defensin alpha 1
Protein Name: Neutrophil defensin 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for alpha Defensin 1

Target: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Alternative Name: DEFA1 (DEFA1 Products)

Synonyms: DEF1 antibody, DEFA2 antibody, HNP-1 antibody, HP-1 antibody, HP1 antibody, MRS antibody, Defcr antibody, Defcr1 antibody, DEFA1 antibody, Defa antibody, Def antibody, GB19392 antibody, defensin alpha 1 antibody, defensin, alpha 1 antibody, defensin alpha 5 antibody, alpha-defensin 1A antibody, defensin 1 antibody, neutrophil defensin 1 antibody, DEFA1 antibody, Defa1 antibody, Defa5 antibody, MNP1A antibody, Def1 antibody, LOC107973256 antibody

Background: Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.

Synonyms: DEF1 | DEFA1 | DEFA1B | DEFA2 | Defensin 1 | Defensin | HNP-1 | HNP-2 | HNP1 | HP-1 | HP-2 | HP1 | HP2 | MRS | P59665

Gene ID: 1667

UniProt: P59665

Pathways: Cellular Response to Molecule of Bacterial Origin