CHRNA5 antibody (N-Term)
-
- Target See all CHRNA5 Antibodies
- CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))
-
Binding Specificity
- AA 44-76, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHRNA5 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Neuronal acetylcholine receptor subunit alpha-5(CHRNA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- AKHEDSLLKD LFQDYERWVR PVEHLNDKIK IKF
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Neuronal acetylcholine receptor subunit alpha-5(CHRNA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cholinergic receptor nicotinic alpha 5 subunit
Protein Name: Neuronal acetylcholine receptor subunit alpha-5 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human CHRNA5 (44-76aa AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CHRNA5 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))
- Alternative Name
- CHRNA5 (CHRNA5 Products)
- Synonyms
- zgc:110642 antibody, LNCR2 antibody, Acra-5 antibody, Acra5 antibody, cholinergic receptor, nicotinic, alpha 5 antibody, cholinergic receptor nicotinic alpha 5 subunit antibody, cholinergic receptor nicotinic alpha 5 subunit L homeolog antibody, cholinergic receptor, nicotinic, alpha polypeptide 5 antibody, chrna5 antibody, CHRNA5 antibody, chrna5.L antibody, Chrna5 antibody
- Background
-
Neuronal acetylcholine receptor subunit alpha-5 is a protein that in humans is encoded by the CHRNA5 gene. It is mapped to 15q25.1. The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).
Synonyms: AChR | CHRNA 5 | CHRNA5 | LNCR2 | NACHRA 5 | NACHRA5 | P30532 - Gene ID
- 1138
- UniProt
- P30532
-