Annexin VIII antibody (N-Term)

Catalog No. ABIN5518736

Product Details anti-Annexin VIII Antibody

Target: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Binding Specificity: AA 20-61, N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin VIII antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Annexin A8(ANXA8) detection. Tested with WB in Human.

Sequence: HFNPDPDAET LYKAMKGIGT NEQAIIDVLT KRSNTQRQQI AK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Annexin A8(ANXA8) detection. Tested with WB in Human.
Gene Name: annexin A8
Protein Name: Annexin A8

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-Annexin VIII antibody (ABIN5518736)

Salenius, Haapanen, Harju, Jokela, Riekkinen: "Late carotid restenosis: aetiologic factors for recurrent carotid artery stenosis during long-term follow-up." in: European journal of vascular surgery, Vol. 3, Issue 3, pp. 271-7, (1989) (PubMed).

Target Details for Annexin VIII

Target: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Alternative Name: ANXA8 (ANXA8 Products)

Synonyms: ANX8 antibody, ANXA8L1 antibody, ANXA8L2 antibody, AI466995 antibody, Anx8 antibody, anx8 antibody, MGC85309 antibody, ANXA8 antibody, annexin A8 antibody, annexin A8 S homeolog antibody, ANXA8 antibody, Anxa8 antibody, anxa8.S antibody, LOC694628 antibody, LOC100052045 antibody

Background: ANXA8 is also known as ANNEXIN VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Synonyms: Annexin-8 | AnnexinVIII | ANX8 | ANXA8 | P13928 | VAC-beta | Vascular anticoagulant-beta | Annexin VIII

Gene ID: 653145

UniProt: P13928