Annexin VIII antibody (N-Term)
-
- Target See all Annexin VIII (ANXA8) Antibodies
- Annexin VIII (ANXA8) (Annexin A8 (ANXA8))
-
Binding Specificity
- AA 20-61, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Annexin VIII antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Annexin A8(ANXA8) detection. Tested with WB in Human.
- Sequence
- HFNPDPDAET LYKAMKGIGT NEQAIIDVLT KRSNTQRQQI AK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Annexin A8(ANXA8) detection. Tested with WB in Human.
Gene Name: annexin A8
Protein Name: Annexin A8 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product ANXA8 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Late carotid restenosis: aetiologic factors for recurrent carotid artery stenosis during long-term follow-up." in: European journal of vascular surgery, Vol. 3, Issue 3, pp. 271-7, (1989) (PubMed).
: "
-
Late carotid restenosis: aetiologic factors for recurrent carotid artery stenosis during long-term follow-up." in: European journal of vascular surgery, Vol. 3, Issue 3, pp. 271-7, (1989) (PubMed).
-
- Target
- Annexin VIII (ANXA8) (Annexin A8 (ANXA8))
- Alternative Name
- ANXA8 (ANXA8 Products)
- Background
-
ANXA8 is also known as ANNEXIN VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
Synonyms: Annexin-8 | AnnexinVIII | ANX8 | ANXA8 | P13928 | VAC-beta | Vascular anticoagulant-beta | Annexin VIII - Gene ID
- 653145
- UniProt
- P13928
-