FZD10 antibody

Catalog No. ABIN5516677

Product Details anti-FZD10 Antibody

Target: FZD10 (Frizzled Family Receptor 10 (FZD10))

Reactivity: Human, Mouse, Pig, Cow, Dog, Horse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD10 antibody is un-conjugated

Application: Immunofluorescence (IF)

Sequence: GMWIWTSKTL QSWQQVCSRR LKKKSRRKPA SVITSGGIYK KAQHPQKTHH

Predicted Reactivity: Cow: 92%, Dog: 92%, Horse: 92%, Human: 100%, Mouse: 92%, Pig: 100%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Target Details for FZD10

Target: FZD10 (Frizzled Family Receptor 10 (FZD10))

Alternative Name: FZD10 (FZD10 Products)

Background: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.

Alias Symbols: Fz10, FzE7, CD350, FZ-10, hFz10,

Protein Size: 581

Gene ID: 11211

NCBI Accession: NM_007197, NP_009128

UniProt: Q9ULW2

Pathways: WNT Signaling