POLQ antibody (C-Term)
-
- Target See all POLQ Antibodies
- POLQ (Polymerase (DNA Directed), theta (POLQ))
-
Binding Specificity
- C-Term
- Reactivity
- Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This POLQ antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Sequence
- GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL
- Predicted Reactivity
- Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 93%, Human: 100%, Mouse: 93%, Rabbit: 86%, Rat: 100%
- Characteristics
- This is a rabbit polyclonal antibody against POLQ. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (< a href="mailto:info@avivasysbio.com">info@avivasysbio.com).
- Purification
- Affinity Purified
- Immunogen
- The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ
- Top Product
- Discover our top product POLQ Primary Antibody
-
anti-Polymerase (DNA Directed), theta (POLQ) (AA 2572-2680) antibody
POLQ Reactivity: Human ELISA, WB Host: Mouse Monoclonal 1C11 unconjugated
anti-Polymerase (DNA Directed), theta (POLQ) (AA 181-230) antibodyPOLQ Reactivity: Human ELISA, IHC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- -20 °C
- Storage Comment
- For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
-
- Target
- POLQ (Polymerase (DNA Directed), theta (POLQ))
- Alternative Name
- POLQ (POLQ Products)
- Synonyms
- POLH antibody, PRO0327 antibody, A430110D14Rik antibody, DNA polymerase theta antibody, polymerase (DNA directed), theta antibody, POLQ antibody, polq antibody, LOC100179525 antibody, Polq antibody
- Background
-
POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.
Alias Symbols: DKFZp781A0112, POLH, PRO0327
Protein Interaction Partner: AP2S1,
Protein Size: 1762 - Gene ID
- 10721
- UniProt
- O75417
-
