PPT1 antibody

Catalog No. ABIN4952244

Product Details anti-PPT1 Antibody

Target: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Purification: Antigen affinity

Immunogen: Amino acids KEDVYRNHSIFLADINQERGINESYKKNLMALKK of human PPT1 were used as the immunogen for the PPT1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PPT1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PPT1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PPT1

Target: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Alternative Name: PPT1 (PPT1 Products)

Synonyms: CLN1 antibody, INCL antibody, PPT antibody, 9530043G02Rik antibody, AA960502 antibody, C77813 antibody, D4Ertd184e antibody, Ppt antibody, wu:fj17f04 antibody, zgc:63969 antibody, PPT-1 antibody, ppt1 antibody, palmitoyl-protein thioesterase 1 antibody, Palmitoyl-protein thioesterase 1 antibody, palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile) antibody, palmitoyl-protein thioesterase 1 L homeolog antibody, PPT1 antibody, MGYG_00692 antibody, Ppt1 antibody, ppt-1 antibody, ppt1 antibody, ppt1.L antibody

Background: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.

UniProt: P50897

Pathways: SARS-CoV-2 Protein Interactome