PAX2A antibody
-
- Target See all PAX2A Antibodies
- PAX2A (Paired Box Gene 2a (PAX2A))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PAX2A antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogen
- Amino acids RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH of human PAX2 were used as the immunogen for the PAX2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product PAX2A Primary Antibody
-
-
- Application Notes
- Optimal dilution of the PAX2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the PAX2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- PAX2A (Paired Box Gene 2a (PAX2A))
- Alternative Name
- PAX2 (PAX2A Products)
- Synonyms
- PAPRS antibody, Opdc antibody, Pax-2 antibody, Pax-2a antibody, XPax-2 antibody, XPax2 antibody, pax-2 antibody, pax2 antibody, xPax-2a antibody, PAXZF-B antibody, cb378 antibody, noi antibody, pax-b antibody, pax2.1 antibody, pax2a1 antibody, pax[zf-b] antibody, paxb antibody, pax2.2 antibody, paired box 2 antibody, paired box 2 L homeolog antibody, paired box 2a antibody, paired box 2b antibody, PAX2 antibody, Pax2 antibody, pax2.L antibody, pax2a antibody, pax2b antibody
- Background
- The PAX2 gene encodes Paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
- UniProt
- Q02962
- Pathways
- Carbohydrate Homeostasis, Stem Cell Maintenance, Tube Formation
-