LCAT antibody
-
- Target See all LCAT Antibodies
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LCAT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogen
- Amino acids QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR of mouse LCAT were used as the immunogen for the LCAT antibody.
- Isotype
- IgG
- Top Product
- Discover our top product LCAT Primary Antibody
-
-
- Application Notes
- Optimal dilution of the LCAT antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the LCAT antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
- Alternative Name
- LCAT (LCAT Products)
- Synonyms
- AI046659 antibody, D8Wsu61e antibody, MGC82035 antibody, lcat antibody, MGC88964 antibody, LCAT antibody, lecithin-cholesterol acyltransferase antibody, lecithin cholesterol acyltransferase antibody, lecithin-cholesterol acyltransferase L homeolog antibody, solute carrier family 12 member 4 antibody, fragile site, aphidicolin type, common, fra(13)(q13.2) antibody, LCAT antibody, Lcat antibody, lcat.L antibody, lcat antibody, SLC12A4 antibody, FRA13A antibody
- Background
- LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000).
- UniProt
- P16301
- Pathways
- Lipid Metabolism
-