Involucrin antibody
-
- Target See all Involucrin (IVL) Antibodies
- Involucrin (IVL)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Involucrin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogen
- Amino acids QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK of human Involucrin were used as the immunogen for the Involucrin antibody.
- Isotype
- IgG
- Top Product
- Discover our top product IVL Primary Antibody
-
-
- Application Notes
- Optimal dilution of the Involucrin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the Involucrin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Involucrin (IVL)
- Alternative Name
- Involucrin (IVL Products)
- Synonyms
- INV antibody, NPH2 antibody, NPHP2 antibody, 1110019C06Rik antibody, IVL antibody, Nphp2 antibody, inv antibody, involucrin antibody, inversin antibody, IVL antibody, INVS antibody, Ivl antibody, Invs antibody
- Background
- Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by the transglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms.
- UniProt
- P07476
-