ICA1 antibody
-
- Target See all ICA1 Antibodies
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ICA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogen
- Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product ICA1 Primary Antibody
-
-
- Application Notes
- Optimal dilution of the ICA1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the ICA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
- Alternative Name
- ICA1 (ICA1 Products)
- Synonyms
- ica1 antibody, MGC52730 antibody, ICA1 antibody, DKFZp469G0321 antibody, zgc:92566 antibody, 69kDa antibody, ICA69 antibody, Ica69 antibody, MGC83241 antibody, ICAp69 antibody, islet cell autoantigen 1 L homeolog antibody, islet cell autoantigen 1 antibody, Islet cell autoantigen 1 antibody, islet cell autoantigen 1 S homeolog antibody, ica1.L antibody, ICA1 antibody, ica1 antibody, ica69 antibody, Ica1 antibody, ica1.S antibody
- Background
- Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
- UniProt
- Q05084
-