EWSR1 antibody
-
- Target See all EWSR1 Antibodies
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EWSR1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Purification
- Antigen affinity
- Immunogen
- Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product EWSR1 Primary Antibody
-
-
- Application Notes
- Optimal dilution of the EWSR1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 1-2 μg/mL,ICC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the EWSR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
- Alternative Name
- EWS / EWSR1 (EWSR1 Products)
- Synonyms
- EWS antibody, bK984G1.4 antibody, AU018891 antibody, Ews antibody, Ewsh antibody, EWSR1 antibody, fc04c01 antibody, wu:fc04c01 antibody, DKFZp459K1116 antibody, ewsr1 antibody, ewsr1.S antibody, fb40b11 antibody, fusl antibody, wu:fb40b11 antibody, wu:fb75g09 antibody, zgc:55864 antibody, EWS RNA binding protein 1 antibody, Ewing sarcoma breakpoint region 1 antibody, EWS RNA-binding protein 1 antibody, EWS RNA-binding protein 1a antibody, EWS RNA binding protein 1 L homeolog antibody, EWS RNA-binding protein 1b antibody, EWSR1 antibody, Ewsr1 antibody, ewsr1a antibody, ewsr1 antibody, ewsr1.L antibody, ewsr1b antibody
- Background
- This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.
- UniProt
- Q01844
-