TUBB3 antibody (C-Term)
-
- Target See all TUBB3 Antibodies
- TUBB3 (Tubulin, beta 3 (TUBB3))
-
Binding Specificity
- AA 383-412, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TUBB3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- EQFTAMFRRK AFLHWYTGEG MDEMEFTEAE
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: tubulin beta 3 class III
Protein Name: Tubulin beta-3 chain - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Beta III Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product TUBB3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Pim-3 is a Critical Risk Factor in Development and Prognosis of Prostate Cancer." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 22, pp. 4254-4260, (2017) (PubMed).
: "Lentiviral-mediated growth-associated protein-43 modification of bone marrow mesenchymal stem cells improves traumatic optic neuropathy in rats." in: Molecular medicine reports, Vol. 12, Issue 4, pp. 5691-700, (2016) (PubMed).
: "The potential role of HMGB1 release in peritoneal dialysis-related peritonitis." in: PLoS ONE, Vol. 8, Issue 1, pp. e54647, (2013) (PubMed).
: "
-
Pim-3 is a Critical Risk Factor in Development and Prognosis of Prostate Cancer." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 22, pp. 4254-4260, (2017) (PubMed).
-
- Target
- TUBB3 (Tubulin, beta 3 (TUBB3))
- Alternative Name
- TUBB3 (TUBB3 Products)
- Background
-
Tubulin beta-3 chain is a protein that in humans is encoded by the TUBB3 gene. This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
Synonyms: beta 3 tubulin | beta-4 | CDCBM | CDCBM1 | CFEOM3A | CFEOM3 | FEOM3 | M(beta)3 | M(beta)6 | MC1R | Tubb 3 | TUBB3 | TUBB4 | Tubulin beta 3 | Tubulin beta 3 chain | Tubulin beta 4 | Tubulin beta-4 chain | Tubulin beta III | Tubulin beta-III | Q13509 - Gene ID
- 10381
- UniProt
- Q13509
- Pathways
- Microtubule Dynamics, M Phase
-