TUBB3 antibody (C-Term)

Catalog No. ABIN4886757

Product Details anti-TUBB3 Antibody

Target: TUBB3 (Tubulin, beta 3 (TUBB3))

Binding Specificity: AA 383-412, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBB3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: EQFTAMFRRK AFLHWYTGEG MDEMEFTEAE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: tubulin beta 3 class III
Protein Name: Tubulin beta-3 chain

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta III Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-TUBB3 antibody (ABIN4886757)

Qu, Zhang, Du, Wang, Yang, Guo, Wang, Zhang, Xu: "Pim-3 is a Critical Risk Factor in Development and Prognosis of Prostate Cancer." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 22, pp. 4254-4260, (2017) (PubMed).

Zhu, Liu, Wang, Nie, He, Zhang, Liu, Su: "Lentiviral-mediated growth-associated protein-43 modification of bone marrow mesenchymal stem cells improves traumatic optic neuropathy in rats." in: Molecular medicine reports, Vol. 12, Issue 4, pp. 5691-700, (2016) (PubMed).

Cao, Li, Li, Xiong, Zhou, Fan, Yu, Mao: "The potential role of HMGB1 release in peritoneal dialysis-related peritonitis." in: PLoS ONE, Vol. 8, Issue 1, pp. e54647, (2013) (PubMed).

Target Details for TUBB3

Target: TUBB3 (Tubulin, beta 3 (TUBB3))

Alternative Name: TUBB3 (TUBB3 Products)

Synonyms: CDCBM antibody, CFEOM3A antibody, TUBB4 antibody, beta-4 antibody, TUBB3 antibody, 3200002H15Rik antibody, M(beta)3 antibody, M(beta)6 antibody, tubb3 antibody, tubulin beta 3 class III antibody, tubulin, beta 3 class III antibody, tubulin beta 3 class III L homeolog antibody, beta-tubulin 3 antibody, tubulin beta-3 chain antibody, beta tubulin 3 antibody, TUBB3 antibody, Tubb3 antibody, tubb3 antibody, tubb3.L antibody, LOC100581245 antibody, tub3 antibody

Background: Tubulin beta-3 chain is a protein that in humans is encoded by the TUBB3 gene. This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.

Synonyms: beta 3 tubulin | beta-4 | CDCBM | CDCBM1 | CFEOM3A | CFEOM3 | FEOM3 | M(beta)3 | M(beta)6 | MC1R | Tubb 3 | TUBB3 | TUBB4 | Tubulin beta 3 | Tubulin beta 3 chain | Tubulin beta 4 | Tubulin beta-4 chain | Tubulin beta III | Tubulin beta-III | Q13509

Gene ID: 10381

UniProt: Q13509

Pathways: Microtubule Dynamics, M Phase