ST7 antibody (Middle Region)
-
- Target See all ST7 Antibodies
- ST7 (Suppression of Tumorigenicity 7 (ST7))
-
Binding Specificity
- AA 268-309, Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ST7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection. Tested with WB in Human.
- Sequence
- DGCYRRSQQL QHHGSQYEAQ HRRDTNVLVY IKRRLAMCAR RL
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection. Tested with WB in Human.
Gene Name: suppression of tumorigenicity 7
Protein Name: Suppressor of tumorigenicity 7 protein - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRL), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product ST7 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ST7 (Suppression of Tumorigenicity 7 (ST7))
- Alternative Name
- ST7 (ST7 Products)
- Background
-
Suppressor of tumorigenicity protein 7 is a protein that in humans is encoded by the ST7 gene. The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.
Synonyms: ETS7q | FAM4A | FAM4A1 | HELG | RAY1 | SEN4 | ST7 | TSG7 | Q9NRC1 - Gene ID
- 7982
-