SAFB antibody (C-Term)
-
- Target See all SAFB Antibodies
- SAFB (Scaffold Attachment Factor B (SAFB))
-
Binding Specificity
- AA 715-754, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SAFB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Scaffold attachment factor B1(SAFB) detection. Tested with WB in Human.
- Sequence
- DLDRRDDAYW PEAKRAALDE RYHSDFNRQD RFHDFDHRDR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Scaffold attachment factor B1(SAFB) detection. Tested with WB in Human.
Gene Name: scaffold attachment factor B
Protein Name: Scaffold attachment factor B1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human SAFB (715-754aa DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR), different from the related mouse and rat sequences by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SAFB Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SAFB (Scaffold Attachment Factor B (SAFB))
- Alternative Name
- SAFB (SAFB Products)
- Synonyms
- HAP antibody, HET antibody, SAF-B1 antibody, SAFB1 antibody, 3110021E02Rik antibody, 5330423C17Rik antibody, AU018122 antibody, D18386 antibody, E130307D12 antibody, zgc:55387 antibody, wu:fb40a03 antibody, wu:fd42g06 antibody, SAFB2 antibody, SAFB antibody, scaffold attachment factor B antibody, scaffold attachment factor B S homeolog antibody, SAFB-like transcription modulator antibody, Scaffold attachment factor B antibody, SAFB antibody, Safb antibody, safb antibody, safb.S antibody, LOC5570070 antibody, CpipJ_CPIJ017179 antibody, Bm1_49330 antibody, LOAG_00080 antibody
- Background
-
Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: HAP | HET | SAF B | SAF-B | SAF-B1 | SAFB 1 | SAFB | SAFB1 | Q15424 - Gene ID
- 6294
- UniProt
- Q15424
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway
-