NFIA antibody (Middle Region)

Catalog No. ABIN4886680

Product Details anti-NFIA Antibody

Target: NFIA (Nuclear Factor I/A (NFIA))

Binding Specificity: AA 180-224, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NFIA antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Nuclear factor 1 A-type(NFIA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: AYFVHAADSS QSESPSQPSD ADIKDQPENG HLGFQDSFVT SG

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Nuclear factor 1 A-type(NFIA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: nuclear factor I A
Protein Name: Nuclear factor 1 A-type

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSG VFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for NFIA

Target: NFIA (Nuclear Factor I/A (NFIA))

Alternative Name: NFIA (NFIA Products)

Synonyms: NFIA antibody, CTF antibody, NF-I/A antibody, NF1-A antibody, NFI-A antibody, NFI-L antibody, si:ch211-88d2.2 antibody, wu:fq27e07 antibody, zgc:158351 antibody, CNFI-A antibody, cNFI-A3 antibody, 1110047K16Rik antibody, 9430022M17Rik antibody, NF1A antibody, nuclear factor I A antibody, nuclear factor I/A antibody, NFIA antibody, nfia antibody, Nfia antibody

Background: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

Synonyms: CTF | NF I/A | NF-I/A | NF1-A | NFI A | NFI L | NFI-A | NFIA | Q12857

Gene ID: 4774

UniProt: Q12857