ITLN1/Omentin antibody (N-Term)
-
- Target See all ITLN1/Omentin (ITLN1) Antibodies
- ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))
-
Binding Specificity
- AA 19-59, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ITLN1/Omentin antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Intelectin-1(ITLN1) detection. Tested with WB, IHC-P in Human.
- Sequence
- TDEANTYFKE WTCSSSPSLP RSCKEIKDEC PSAFDGLYFL R
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Intelectin-1(ITLN1) detection. Tested with WB, IHC-P in Human.
Gene Name: intelectin 1
Protein Name: Intelectin-1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19-59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR).
- Isotype
- IgG
- Top Product
- Discover our top product ITLN1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))
- Alternative Name
- ITLN1 (ITLN1 Products)
- Background
-
Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.
Synonyms: Endothelial lectin HL 1 | Endothelial lectin HL-1 | hIntL | HL1 | HL 1 | Intelectin | Intelectin-1 | Intelectin 1 | INTL | ITLN | ITLN-1 | ITLN1 | LFR | Omentin | Q8WWA0 - Gene ID
- 55600
-