HNRNPH1 antibody (N-Term)
-
- Target See all HNRNPH1 Antibodies
- HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))
-
Binding Specificity
- AA 23-52, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) detection. Tested with WB in Human.
- Sequence
- SADEVQRFFS DCKIQNGAQG IRFIYTREGR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) detection. Tested with WB in Human.
Gene Name: heterogeneous nuclear ribonucleoprotein H1 (H)
Protein Name: Heterogeneous nuclear ribonucleoprotein H - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP H (23-52aa SADEVQRFFSDCKIQNGAQGIRFIYTREGR), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product HNRNPH1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))
- Alternative Name
- HNRNPH1 (HNRNPH1 Products)
- Synonyms
- HNRPH antibody, HNRPH1 antibody, hnRNPH antibody, HNRNPH1 antibody, hnrph antibody, hnrnph antibody, hnrph1 antibody, hnrnph2 antibody, MGC78776 antibody, hnrph2 antibody, MGC80081 antibody, MGC130700 antibody, MGC69543 antibody, AI642080 antibody, E430005G16Rik antibody, Hnrnph antibody, Hnrph1 antibody, Hnrph antibody, zgc:77712 antibody, heterogeneous nuclear ribonucleoprotein H1 antibody, heterogeneous nuclear ribonucleoprotein H2 antibody, heterogeneous nuclear ribonucleoprotein H1 S homeolog antibody, heterogeneous nuclear ribonucleoprotein H1 L homeolog antibody, HNRNPH1 antibody, HNRNPH2 antibody, hnrnph1.S antibody, hnrnph1.L antibody, hnrnph1 antibody, Hnrnph1 antibody
- Background
-
Heterogeneous nuclear ribonucleoprotein H is a protein that in humans is encoded by the HNRNPH1 gene. This gene encodes a member of a subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA. These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some may shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNA and is very similar to the family member HNRPF. This gene may be associated with hereditary lymphedema type I. Alternatively spliced transcript variants have been described.
Synonyms: hnRNP H | hnRNPH | Hnrnph1 | HNRPH 1 | HNRPH | HNRPH1 protein | P31943 - Gene ID
- 3187
- UniProt
- P31943
-