HNRNPA1 antibody (N-Term)

Catalog No. ABIN4886621

Product Details anti-HNRNPA1 Antibody

Target: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Binding Specificity: AA 8-42, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein A1(HNRNPA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KEPEQLRKLF IGGLSFETTD ESLRSHFEQW GTLTD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein A1(HNRNPA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heterogeneous nuclear ribonucleoprotein A1
Protein Name: Heterogeneous nuclear ribonucleoprotein A1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HNRNPA1

Target: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Alternative Name: HNRNPA1 (HNRNPA1 Products)

Synonyms: HNRPA1 antibody, HNRPA1L3 antibody, hnRNP A1 antibody, hnRNP-A1 antibody, hnrpa1 antibody, TPT1P antibody, HNRNPA1 antibody, D15Ertd119e antibody, Hdp antibody, Hnrpa1 antibody, hnrnp-A1 antibody, ROA1 antibody, zgc:66127 antibody, heterogeneous nuclear ribonucleoprotein A1 antibody, heterogeneous nuclear ribonucleoprotein A1b antibody, Heterogeneous nuclear ribonucleoprotein A1 antibody, heterogeneous nuclear ribonucleoprotein A1 S homeolog antibody, ribonucleoprotein A1a antibody, heterogeneous nuclear ribonucleoprotein A1-like antibody, heterogeneous nuclear ribonucleoprotein A1a antibody, HNRNPA1 antibody, hnrnpa1b antibody, LOC100101226 antibody, roa1 antibody, Hnrnpa1 antibody, hnrnpa1.S antibody, hnrnpa1 antibody, LOC100359118 antibody, hnrnpa1a antibody

Background: Heterogeneous nuclear ribonucleoprotein A1 is a protein that in humans is encoded by the HNRNPA1 gene. This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.

Synonyms: ALS19 | ALS20 | HNRNPA 1 | HNRNPA1 | hnRNP A1 | HNRPA1 | UP 1 | IBMPFD3 | HNRPA1L3 | P09651

Gene ID: 3178

UniProt: P09651