HMGB2 antibody (N-Term)

Catalog No. ABIN4886620

Product Details anti-HMGB2 Antibody

Target: HMGB2 (High Mobility Group Box 2 (HMGB2))

Binding Specificity: AA 65-97, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HMGB2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for High mobility group protein B2(HMGB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KSDKARYDRE MKNYVPPKGD KKGKKKDPNA PKR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for High mobility group protein B2(HMGB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: high mobility group box 2
Protein Name: High mobility group protein B2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HMGB2 (65-97aa KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HMGB2

Target: HMGB2 (High Mobility Group Box 2 (HMGB2))

Alternative Name: HMGB2 (HMGB2 Products)

Synonyms: HMG2 antibody, C80539 antibody, HMG-2 antibody, Hmg2 antibody, HIGH MOBILITY GROUP BETA 1 antibody, HMG BETA 1 antibody, NFD02 antibody, NFD2 antibody, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02 antibody, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2 antibody, high mobility group B2 antibody, hmgb2 antibody, hmgb2l antibody, im:6909096 antibody, wu:fa20b02 antibody, zgc:101854 antibody, wu:fb22b10 antibody, wu:fc95d12 antibody, zgc:123215 antibody, high mobility group box 2 antibody, high mobility group box 2 S homeolog antibody, high mobility group B2 antibody, high mobility group box 2b antibody, high mobility group box 2a antibody, HMGB2 antibody, Hmgb2 antibody, hmgb2.S antibody, hmgb2b antibody, hmgb2a antibody

Background: High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

Synonyms: C80539 | HMG2 | HMG-2 | HMG 2 | HMG B2 | HMGB2 | P26583

Gene ID: 3148

UniProt: P26583

Pathways: Cellular Response to Molecule of Bacterial Origin