GPI antibody (N-Term)
-
- Target See all GPI Antibodies
- GPI (Glucose-6-Phosphate Isomerase (GPI))
-
Binding Specificity
- AA 5-39, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPI antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Human.
- Sequence
- TRDPQFQKLQ QWYREHRSEL NLRRLFDANK DRFNH
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Human.
Gene Name: glucose-6-phosphate isomerase
Protein Name: Glucose-6-phosphate isomerase - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human GPI (5-39aa TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH), different from the related mouse and rat sequences by sixteen amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product GPI Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- GPI (Glucose-6-Phosphate Isomerase (GPI))
- Alternative Name
- GPI (GPI Products)
- Synonyms
- PGI antibody, Amf antibody, Gpi1 antibody, GPI antibody, DDBDRAFT_0185620 antibody, DDBDRAFT_0231026 antibody, DDB_0185620 antibody, DDB_0231026 antibody, CG8251 antibody, Dmel\\CG8251 antibody, Gpi antibody, pgi antibody, Gpi-1 antibody, Gpi-1r antibody, Gpi-1s antibody, Gpi-1t antibody, Gpi1-r antibody, Gpi1-s antibody, Gpi1-t antibody, Gpi1s antibody, MF antibody, NK antibody, NK/GPI antibody, Org antibody, AMF antibody, GNPI antibody, NLK antibody, PHI antibody, SA-36 antibody, SA36 antibody, gpi antibody, pgi-2 antibody, glucose-6-phosphate isomerase antibody, gpi antibody, glucose-6-phosphate isomerase 1 antibody, gpi Glucose-6-phosphate isomerase antibody, Phosphoglucose isomerase antibody, glucose phosphate isomerase 1 antibody, glucose-6-phosphate isomerase b antibody, GPI antibody, Gpi antibody, gpi antibody, pgi antibody, GPI1 antibody, Pgi antibody, Gpi1 antibody, gpib antibody
- Target Type
- Viral Protein
- Background
-
Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.
Synonyms: AMF | Aurocrine motility factor | GNPI | GPI | Gpi1 | Neuroleukin | NLK | Oxoisomerase | PGI | PHI | SA36 | SA-36 | SA 36 | P06744 - Gene ID
- 2821
- UniProt
- P06744
-