GLA antibody (C-Term)
-
- Target See all GLA Antibodies
- GLA (Galactosidase, alpha (GLA))
-
Binding Specificity
- AA 218-275, C-Term
-
Reactivity
- Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GLA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Alpha-galactosidase A(Gla) detection. Tested with WB in mouse.
- Sequence
- DIQYYCNHWR NFDDVYDSWE SIKNILSWTV VYQKEIVEVA
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Alpha-galactosidase A(Gla) detection. Tested with WB in mouse.
Gene Name: galactosidase, alpha
Protein Name: Alpha-galactosidase A - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product GLA Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- GLA (Galactosidase, alpha (GLA))
- Alternative Name
- Gla (GLA Products)
- Synonyms
- GALA antibody, Ags antibody, zgc:101584 antibody, MGC130872 antibody, SMU.877 antibody, SCF11.21 antibody, AO090005000217 antibody, alpha-GAL antibody, galactosidase alpha antibody, galactosidase, alpha antibody, galactosidase alpha S homeolog antibody, alpha-galactosidase antibody, aga antibody, alpha-galactosidase A antibody, GLA antibody, Gla antibody, gla antibody, gla.S antibody, agaN antibody, aga antibody, agaL antibody, SCO0541 antibody, rafA antibody, melA antibody, galA antibody, ANI_1_2528074 antibody, ANI_1_1502124 antibody, AOR_1_390174 antibody, CpipJ_CPIJ002066 antibody, MCYG_00962 antibody, MCYG_00791 antibody, Tsp_02909 antibody, Tsp_02508 antibody
- Background
-
Alpha-galactosidase is a glycoside hydrolase enzyme that encoded by the GLA gene. This gene is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.
Synonyms: Ags | Agalsidase alfa | Alpha D galactosidase A | Alpha gal A | GALA | Galactosidase, alpha | GLA | GLA protein | Melibiase | P06280 - Gene ID
- 11605
- UniProt
- P51569
- Pathways
- SARS-CoV-2 Protein Interactome
-