DHODH antibody (N-Term)
-
- Target See all DHODH Antibodies
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
-
Binding Specificity
- AA 132-173, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHODH antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- RVFRLPEDQA VINRYGFNSH GLSVVEHRLR ARQQKQAKLT E
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: dihydroorotate dehydrogenase (quinone)
Protein Name: Dihydroorotate dehydrogenase (quinone), mitochondrial - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product DHODH Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
- Alternative Name
- DHODH (DHODH Products)
- Background
-
Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
Synonyms: DHOdehase | Dhodh | POADS | URA1 | Q02127 - Gene ID
- 1723
- UniProt
- Q02127
- Pathways
- Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus
-