Cofilin 2 antibody (C-Term)

Catalog No. ABIN4886538

Product Details anti-Cofilin 2 Antibody

Target: Cofilin 2 (CFL2)

Binding Specificity: AA 121-153, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cofilin 2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Cofilin-2(CFL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KDAIKKKFTG IKHEWQVNGL DDIKDRSTLG EKL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Cofilin-2(CFL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cofilin 2
Protein Name: Cofilin-2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Cofilin 2

Target: Cofilin 2 (CFL2)

Alternative Name: CFL2 (CFL2 Products)

Synonyms: NEM7 antibody, CFL2 antibody, zgc:77288 antibody, cf12 antibody, cofilin 2 antibody, cofilin 2 (non-muscle) antibody, cofilin 2 (muscle) antibody, cofilin 2, muscle antibody, cofilin-2 antibody, CFL2 antibody, cfl2 antibody, Cfl2 antibody, cf12 antibody, LOC100359205 antibody

Background: Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH -dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.

Synonyms: CFL 2 | CFL2 | CFL-2 | Cofilin 2 muscle | Cofilin | Cofilin muscle | Cofilin2 | Cofilin 2 | Cofilin-2 | NEM 7 | NEM7 | Q9Y281

Gene ID: 1073

UniProt: Q9Y281

Pathways: Caspase Cascade in Apoptosis