Calpastatin antibody (Middle Region)
-
- Target See all Calpastatin (CAST) Antibodies
- Calpastatin (CAST)
-
Binding Specificity
- AA 275-310, Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Calpastatin antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Calpastatin(CAST) detection. Tested with WB, IHC-P in Human.
- Sequence
- QEKKRKVEKD TMSDQALEAL SASLGTRQAE PELDLR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Calpastatin(CAST) detection. Tested with WB, IHC-P in Human.
Gene Name: calpastatin
Protein Name: Calpastatin - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin (275-310aa QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by eleven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CAST Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Calpastatin (CAST)
- Alternative Name
- CAST (CAST Products)
- Background
-
Calpastatin is a protein that in humans is encoded by the CAST gene. It is mapped to 5q15. The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described.
Synonyms: BS 17 | Calpain inhibitor | Calpastatin | Cast | PLACK | Sperm BS 17 component | Sperm BS-17 component | P20810 - Gene ID
- 831
- UniProt
- P20810
-