AGO2 antibody (N-Term)
-
- Target See all AGO2 Antibodies
- AGO2 (Argonaute 2 (AGO2))
-
Binding Specificity
- AA 129-169, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AGO2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Protein argonaute-2(AGO2) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- KVSIKWVSCV SLQALHDALS GRLPSVPFET IQALDVVMRH L
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Protein argonaute-2(AGO2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: argonaute 2, RISC catalytic component
Protein Name: Protein argonaute-2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product AGO2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- AGO2 (Argonaute 2 (AGO2))
- Alternative Name
- AGO2 (AGO2 Products)
- Synonyms
- EIF2C2 antibody, T19E23.7 antibody, T19E23_7 antibody, argonaute 2 antibody, Q10 antibody, Eif2c2 antibody, Argonaute2 antibody, eif2c1 antibody, eif2c2 antibody, 1110029L17Rik antibody, 2310051F07Rik antibody, AI225898 antibody, AL022874 antibody, AW546247 antibody, ENSMUSG00000072493 antibody, Gerp95 antibody, Gm10365 antibody, mKIAA4215 antibody, AGO2 antibody, AG02 antibody, AGO 2 antibody, Ago-2 antibody, Ago2 antibody, CG13452 antibody, CG7439 antibody, Dm Ago2 antibody, Dmel\\CG7439 antibody, ago antibody, ago-2 antibody, ago2 antibody, dAGO2 antibody, dAgo2 antibody, eIF2C2 antibody, argonaute 2, RISC catalytic component antibody, Argonaute family protein antibody, argonaute 2, RISC catalytic component L homeolog antibody, argonaute RISC catalytic subunit 2 antibody, argonaute RISC catalytic component 2 antibody, Argonaute 2 antibody, AGO2 antibody, Ago2 antibody, ago2.L antibody, ago2 antibody
- Background
-
Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: Ago 2 | Ago2 | Argonaute2 | Argonaute-2 | Argonaute 2 | dAgo2 | eIF 2C 2 | eIF-2C 2 | eIF2C 2 | Eif2c2 | hAgo2 | PAZ Piwi domain protein | PPD | Q10 | Slicer protein | Q9UKV8 - Gene ID
- 27161
- Pathways
- Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Ribonucleoprotein Complex Subunit Organization
-