ACTN3 antibody (C-Term)

Catalog No. ABIN4886420

Product Details anti-ACTN3 Antibody

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Binding Specificity: AA 574-617, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTN3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Alpha-actinin-3(ACTN3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: EADRERGAIM GIQGEIQKIC QTYGLRPCST NPYITLSPQD INT

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Alpha-actinin-3(ACTN3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: actinin alpha 3 (gene/pseudogene)
Protein Name: Alpha-actinin-3

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ACTN3

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Alternative Name: ACTN3 (ACTN3 Products)

Synonyms: CG8953 antibody, Dmel\\CG8953 antibody, ORF1 antibody, acta-3 antibody, dabp antibody, ACTN2 antibody, actn3 antibody, actnl antibody, zgc:63559 antibody, fb95c03 antibody, wu:fb95c03 antibody, wu:fc11d03 antibody, zgc:77243 antibody, actinin alpha 3 (gene/pseudogene) antibody, actinin alpha 3 antibody, alpha actinin 3 antibody, actinin alpha 3a antibody, actinin alpha 3 (gene/pseudogene) L homeolog antibody, alpha-actinin-3 antibody, actinin alpha 3b antibody, ACTN3 antibody, Actn3 antibody, actn3a antibody, actn3.L antibody, actn3 antibody, LOC100439754 antibody, actn3b antibody

Background: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

Synonyms: Actinin alpha 3 | Alpha-Actinin 3 | Alpha-actinin-3 | ACTN 3 | ACTN3 | Q08043

Gene ID: 89

UniProt: Q08043

Pathways: Cell-Cell Junction Organization