ACADVL antibody (C-Term)

Catalog No. ABIN4886415

Product Details anti-ACADVL Antibody

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Binding Specificity: AA 538-576, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACADVL antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Very long-chain specific acyl-CoA dehydrogenase, mitochondrial(ACADVL) detection. Tested with WB in Human,Rat.

Sequence: RALEQFATVV EAKLIKHKKG IVNEQFLLQR LADGAIDLY

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Very long-chain specific acyl-CoA dehydrogenase, mitochondrial(ACADVL) detection. Tested with WB in Human,Rat.
Gene Name: acyl-CoA dehydrogenase, very long chain
Protein Name: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACADVL (538-576aa RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ACADVL

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Alternative Name: ACADVL (ACADVL Products)

Background: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

Synonyms: ACAD 6 | ACAD6 | Acadvl | LCACD | VLCAD | P49748

Gene ID: 37

UniProt: P49748

Pathways: ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process