ACAA2 antibody (Middle Region)
-
- Target See all ACAA2 Antibodies
- ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))
-
Binding Specificity
- AA 207-242, Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACAA2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for 3-ketoacyl-CoA thiolase, mitochondrial(ACAA2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- EVKTKKGKQT MQVDEHARPQ TTLEQLQKLP PVFKKD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for 3-ketoacyl-CoA thiolase, mitochondrial(ACAA2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: acetyl-CoA acyltransferase 2
Protein Name: 3-ketoacyl-CoA thiolase, mitochondrial - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human ACAA2 (207-242aa EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ACAA2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))
- Alternative Name
- ACAA2 (ACAA2 Products)
- Background
-
3-Ketoacyl-CoA thiolase, mitochondrial, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene. The ACAA2 gene encodes a 41.9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides. The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. Additionally, ACAA2 has been shown to be a functional BNIP3 binding partner, which provides a possible link between fatty acid metabolism and cell apoptosis.
Synonyms: ACAA 2 | Acaa2 | Beta ketothiolase | Beta-ketothiolase | DSAEC | P42765 - Gene ID
- 10449
- UniProt
- P42765
- Pathways
- Monocarboxylic Acid Catabolic Process
-