ZP2 antibody (N-Term)

Catalog No. ABIN3044563

Product Details anti-ZP2 Antibody

Target: ZP2 (Zona Pellucida Glycoprotein 2 (ZP2))

Binding Specificity: AA 511-544, N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZP2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Purpose: Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 2(ZP2) detection. Tested with WB, IHC-P, IHC-F in Human.

Sequence: ENEYPLVRFL RQPIYMEVRV LNRDDPNIKL VLDD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 2(ZP2) detection. Tested with WB, IHC-P, IHC-F in Human.
Gene Name: zona pellucida glycoprotein 2 (sperm receptor)
Protein Name: Zona pellucida sperm-binding protein 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ZP2 (511-544aa ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
IHC-F: Concentration: 0.5-1 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P) and IHC(F).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ZP2

Target: ZP2 (Zona Pellucida Glycoprotein 2 (ZP2))

Alternative Name: ZP2 (ZP2 Products)

Synonyms: fa12e07 antibody, wu:fa12e07 antibody, zgc:152728 antibody, zp2 antibody, Zp-2 antibody, ZPA antibody, zona pellucida glycoprotein 2, tandem duplicate 5 antibody, zona pellucida glycoprotein 2 antibody, zp2.5 antibody, Zp2 antibody, ZP2 antibody

Background: Zona pellucida sperm-binding protein 2 is a protein that in humans is encoded by the ZP2 gene. The sperm-binding domain on the ZP2 protein is necessary in both humans and mice for oocyte-sperm recognition and penetration of the zona pellucida. It is also responsible for the primary block to polyspermy in mammals. The oocyte has cortical granules peripherally located under the cortex that contain a proteolytic protein called ovastacin. After the sperm binds to ZP2, the cortical granules are exocytosed releasing ovastacin into the perivitelline space. Ovastacin cleaves ZP2 at the N terminus, preventing more sperm from binding and penetrating the oocyte, thus hardening the zona pellucida. Ovastacin is only found in oocytes, and is part of the astacin family of metalloendoproteases. Female mice engineered without ovastacin showed that ZP2 was not cleaved after fertilization.

Synonyms: OTTHUMP00000115849 antibody|Processed zona pellucida sperm-binding protein 2 antibody|Zona pellucida glycoprotein 2 antibody|zona pellucida glycoprotein ZP2 antibody|Zona pellucida protein A antibody|Zp-2 antibody|ZP2 antibody|ZP2_HUMAN antibody|ZPA antibody

Gene ID: 7783

UniProt: Q05996