VRK1 antibody (C-Term)
-
- Target See all VRK1 Antibodies
- VRK1 (Vaccinia Related Kinase 1 (VRK1))
-
Binding Specificity
- AA 292-329, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VRK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase VRK1(VRK1) detection. Tested with WB in Human,Rat.
- Sequence
- EKNKPGEIAK YMETVKLLDY TEKPLYENLR DILLQGLK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase VRK1(VRK1) detection. Tested with WB in Human,Rat.
Gene Name: vaccinia related kinase 1
Protein Name: Serine/threonine-protein kinase VRK1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human VRK1 (292-329aa EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK), different from the related mouse sequence by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product VRK1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- VRK1 (Vaccinia Related Kinase 1 (VRK1))
- Alternative Name
- VRK1 (VRK1 Products)
- Background
-
Serine/threonine-protein kinase VRK1 is an enzyme that in humans is encoded by the VRK1 gene. This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. It is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 Molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.
Synonyms: MGC117401 antibody|MGC138280 antibody|MGC142070 antibody|PCH1 antibody|PCH1A antibody|Serine/threonine protein kinase VRK1 antibody| Serine/threonine-protein kinase VRK1 antibody|Vaccinia related kinase 1 antibody|Vaccinia virus B1R related kinase 1 antibody| Vaccinia-related kinase 1 antibody|VRK1 antibody|VRK1_HUMAN antibody - Gene ID
- 7443
- UniProt
- Q99986
-