TPP1 antibody (Middle Region)

Catalog No. ABIN3044554

Product Details anti-TPP1 Antibody

Target: TPP1 (Tripeptidyl Peptidase I (TPP1))

Binding Specificity: AA 227-261, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Tripeptidyl-peptidase 1(TPP1) detection. Tested with WB, IHC-P in Human.

Sequence: CAQFLEQYFH DSDLAQFMRL FGGNFAHQAS VARVV

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Tripeptidyl-peptidase 1(TPP1) detection. Tested with WB, IHC-P in Human.
Gene Name: tripeptidyl peptidase I
Protein Name: Tripeptidyl-peptidase 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TPP1 (227-261aa CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for TPP1

Target: TPP1 (Tripeptidyl Peptidase I (TPP1))

Alternative Name: TPP1 (TPP1 Products)

Synonyms: cln2 antibody, fa01b09 antibody, im:7149243 antibody, wu:fa01b09 antibody, CLN2 antibody, LPIC antibody, TPP-1 antibody, TPP-I antibody, Cln2 antibody, tripeptidyl peptidase I antibody, tripeptidyl-peptidase 1 antibody, tripeptidyl peptidase 1 antibody, tpp1 antibody, NAEGRDRAFT_78259 antibody, MCYG_00184 antibody, MGYG_05881 antibody, MGYG_00757 antibody, TPP1 antibody, Tpp1 antibody

Background: Tripeptidyl-peptidase 1, also known as Lysosomal pepstatin-insensitive protease, is an enzyme that in humans is encoded by the TPP1 gene. This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.

Synonyms: Cell growth inhibiting gene 1 protein antibody|Cell growth-inhibiting gene 1 protein antibody|Ceroid lipofuscinosis neuronal 2 antibody|Ceroid lipofuscinosis neuronal 2 late infantile (Jansky Bielschowsky disease) antibody|Ceroid lipofuscinosis neuronal 2 late infantile antibody|CLN 2 antibody|CLN2 antibody|GIG 1 antibody|GIG1 antibody|Growth inhibiting protein 1 antibody|LPIC antibody| Lysosomal pepstatin insensitive protease antibody|Lysosomal pepstatin-insensitive protease antibody|MGC21297 antibody|TPP 1 antibody| TPP I antibody|TPP-1 antibody|TPP-I antibody|Tpp1 antibody|TPP1_HUMAN antibody|TPPI antibody|Tripeptidyl aminopeptidase antibody| Tripeptidyl peptidase I antibody|Tripeptidyl-peptidase 1 antibody|Tripeptidyl-peptidase I antibody

Gene ID: 1200

UniProt: O14773

Pathways: Cell Division Cycle, ER-Nucleus Signaling